PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv3_061680_hycw.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family MIKC_MADS
Protein Properties Length: 255aa    MW: 28761.6 Da    PI: 6.5189
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv3_061680_hycw.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF73.51.8e-23959151
                        S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
              SRF-TF  1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
                        k+i+n   rqvtfskRr g++KKA+ELS+LC+ e+ +iifsstgk yeys+
  Bv3_061680_hycw.t1  9 KQIDNINSRQVTFSKRRGGLIKKASELSILCACEIGLIIFSSTGKKYEYSN 59
                        689**********************************************95 PP

2K-box59.21.7e-2010318119100
               K-box  19 qelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrkklee 100
                          e++ L++e+  L+    h++G++LesLs+ eLqqLeq+L ++l +iR++K++ll eq e+++ +e+++++en+aLrk++ee
  Bv3_061680_hycw.t1 103 DEVTALREEVTRLRM---HMQGKGLESLSFGELQQLEQHLCDGLYSIRETKERLLWEQYEKSKLQEEKTSRENEALRKEVEE 181
                         689999999999998...6************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM004323.8E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.623161IPR002100Transcription factor, MADS-box
CDDcd002653.00E-37274No hitNo description
SuperFamilySSF554551.7E-28274IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-25323IPR002100Transcription factor, MADS-box
PfamPF003191.3E-211157IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-252338IPR002100Transcription factor, MADS-box
PRINTSPR004042.8E-253859IPR002100Transcription factor, MADS-box
PROSITE profilePS512978.8795185IPR002487Transcription factor, K-box
PfamPF014866.8E-13103179IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 255 aa     Download sequence    Send to blast
MGRGKIEIKQ IDNINSRQVT FSKRRGGLIK KASELSILCA CEIGLIIFSS TGKKYEYSNV  60
GMQKVLRRYM NHKDHVPAST AVPANSSNAV AVVEHVVENP QPDEVTALRE EVTRLRMHMQ  120
GKGLESLSFG ELQQLEQHLC DGLYSIRETK ERLLWEQYEK SKLQEEKTSR ENEALRKEVE  180
ELKQSMKSSC SESNSLKRRH LNGSTSDEVC IAEKEVESEN FLRLGLSVVP KTESTSDGSI  240
ADQIMVFEPN DAPNC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1egw_D1e-19272171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_C1e-19272171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_B1e-19272171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
1egw_A1e-19272171MADS BOX TRANSCRIPTION ENHANCER FACTOR 2, POL
3p57_J1e-19272171Myocyte-specific enhancer factor 2A
3p57_I1e-19272171Myocyte-specific enhancer factor 2A
3p57_D1e-19272171Myocyte-specific enhancer factor 2A
3p57_C1e-19272171Myocyte-specific enhancer factor 2A
3p57_B1e-19272171Myocyte-specific enhancer factor 2A
3p57_A1e-19272171Myocyte-specific enhancer factor 2A
3kov_J1e-19272171Myocyte-specific enhancer factor 2A
3kov_I1e-19272171Myocyte-specific enhancer factor 2A
3kov_B1e-19272171Myocyte-specific enhancer factor 2A
3kov_A1e-19272171Myocyte-specific enhancer factor 2A
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010673137.10.0PREDICTED: agamous-like MADS-box protein AGL15
TrEMBLA0A0J8CMU90.0A0A0J8CMU9_BETVU; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G13790.11e-51AGAMOUS-like 15